TTHERM_00656140

Length: 168 bp

protein Sequence

MEDLNQKKEQQNKDQLNLQKQEERESAFKKLYKDYVNQKQNEINLYNIFKNNVLLEDFTYSRRSALAFIFVPTLLNLYYIWKPYSPMKNTFRIGTIIGCFLHFNYALKKDFRELVKKDTELANKARLYAQNISINNLSVRSFQKETNEIADKRKQKIEPVQVQDIQNK*