TTHERM_00657300

Length: 89 bp

protein Sequence

MDNCTIQTMTSNALKKANHLIMILKLKFLQSETISLGQNYSRKAQKNKNKSTQMLEGMANNAMKINYLQMKLQKIIQMNLNIYKTNNKI*