TTHERM_00657360

Length: 194 bp

protein Sequence

MMNFQRQQDINAVDFFGYYHLMNQFVIRSCKDQLTSIQVKQNSLFEVGYKIGRSVVEKITENCLDKFKEDVEKNNAKCLPQIKFISKDFWSYLFQKDVDKANHNLKGTFYLKVFTFTMFEKLSNTESPEVQEFVSLWYQVIRGLVAGAMKGLSYPSEVSVDSVPPEKPDHIQPFMISIQILNYPALLSSQIQQK*