TTHERM_00660330

Length: 753 bp

protein Sequence

MLSNCLTNKKCNVHPENNAQFALMKKSESNQAFYCSLCLLQQNIDIKLLLSIDDALKKTDTEYIFNWPLGINTTITEYLQDKSSLNKKEQLKQKIIEYYQDLEQQFVKQLSESKQQTLQDLENNSALKTDIINTYNLYFYRINLIHLLSNMDEQKEQIFKELEEKIKQIKYIEYQIEEGVPYKIKQNINQLIKKIQFFDCSLNNTKKSKKDKNSISVILDKNINQMAHNDIFDCMLHEPVNNSLIFQNLLQKNKEYQQIKTSIEQIIKDQERQCLRVQEFNLLDFQQQNTRSKIVKTILHQYYTLSQQQQFEIQLKMNSLSQRNVFIEFLNQKKTEIPQIPSKSQQGNIFENLTQQKNTNLFEVKNNVPITPTPTETKFENKQNIQDNRTETQLIKKMLICGIIEYQVEKQRKTLHISLNKNREGGWEEENQFQIKMDKEIEQQMLFKTYLIDQKKNQQNLNQKQMGDNQKRHFTNKYYENKEPKFNYLHKKVREYTVDNNGKEVPEQSGQNEYKVTSRQSTMIIKKIAQDSEQQKNQNNFPVTLSAIGYAVNHAFQILQAYKQTNSVVGDVKIQMSTLIMEFEAEPLVEGLEKLDYKTVNGKITIQFTLNIQNNEENERKLNSIHISNRVSRNRGYNKGQRVSRKRNYKNNQKPYKPQSKKRGFRSNGNGNQETNQENGYDQNKNQHQHPHNHQNKSNQDNQQQNKGERGNRRNDRTKVNQGKKPNFQPKQRDNQNKRNQQQLLSDGIKEAG*