TTHERM_00666370

Length: 124 bp

protein Sequence

MVFHYTNFVQETNAWWLRRVRPVYCTVLAYYGWWLYDRYYLFGKNATQDIRKDTTEVWEKRAALNKRNWGYNAHYKPELERSMKKVLYADPNYKFPIEWPERYMAETKTLEQVMDEEENWEYYK*