TTHERM_00666640

Length: 296 bp

protein Sequence

MLFTKSIAKFSSAANVKNFAVVGAGQMGTGIAIVANKIGGLNVKIVDSTEKALSGSRKFTESWCDKEIAKNRMTSEEKHQMLSRFSYFTKLEDLNDADFVVEAVTEKFEVKKNIFTTLDQITKPDTILASNTSSISLTKIAATTKRPEKVIGMHFMNPVPVMKLIEIIKGLQTSDETLQTTLDLSHKLGKTTVLANDIPGFILNRTLMPYINEAVYALFEGVATVADIDQAMKLGTNVPMGPLTLADFIGLDTCLLIMQVLHTELGDSKYRPCPLLVNYVNAGYLGKKSGRGFYKY*