TTHERM_00675720

Length: 978 bp

protein Sequence

MKIKANLFLFKVDQMMLLNASKNNSQKIIRAIKNQLNVLQIQPNQNLKYNFCSKNNQNATDKQNIQVKLQEVQKIDQQMHQKLMELEKKIIANQFDEKKFVIQFQSLFNNYNLNKEEQATKLINQLKISIDHVQKLQTIVGVIDKAAKYNIFLSKEFEIKLLNRGLYLIKNEKYYNIKSDEGDLIRALTLVAGLKKIRHLSFYESIIDIIKNEEISKKNLLTIIETLTYNKLLPQLKNGNDITDCLAKLSRLTPNDLEIFSPVSNLICYYLKNKQTISLFNQNTKFSTVSEEIFKSIHNCLFTLLSQQTPDKLDVFLIAEIQNHLEMFAKLSQKEEALFIQRKFNNLFNQYMTRNFAQKQYYDYEKVLRYVKKFIAAPPIVLNPIIVKLIGQTYQTVNPNNISEIVPFLYFLSKTVQNFKVPYESQQVIEKNLQQEKNIIMLSKLMEIYATTHYSNDQNIQDLEQRIIQLSSYSANPTSPLLILFQSLANMHRGQTQSLRYIVDYFKYPGVLDKIEFFDLIVKFIPSLAIKTKELYKFATNMGFQSQTNLIDDTNRIDLDFQNSLEQLWDKVESLVISRIDEIYYDKYPTLLLHFMYANLMKNKYKRIFFILQQRVTQYLDKYTPKQVSEIIYSYARMHEKNNELFFKSIPIILKNIDQFNTIELINIYWGYANVRIYDNQLCTALEESIMKEQTKVNPEGYIQFFHAIGIFSRQINSGSKLDEFIRSKIYNLDQLKINVQQQFALAYAILLFNNRSQYSLFWENIINLILQNQSNFISSPLYMNYLYQIYIHLRYSDSIFLPCMQILLQVLIKNRDSLIRFYKVNKRYTSSDLEKKITQVIDEKIAAPQNDQKVFVVQIKNDIPLIFYDDLRELEQNPKFPEHELIIPYTLDCRKGALCFEVNGPQHYLSDIQNQSSLDGVTLLKKNFLEQLGFKYIEIKYTEFVPGIVKEDSLLTQKVMDIVKEQMKDVNTKKVQQ*