TTHERM_00684590

Length: 461 bp

protein Sequence

MDFAKYFFNTSNTSFFKSSNSNEANNSKIQQNISNKNSDSELSVQSKQIKSNSKDLQQSTGKFNETAFFNNQSTNSSQNIFSSQYKANINKQGQQNALNNMQVGPFQIGNNTNGSIQKANQQQELIFDIKENKTFFPFLSCLKQKKEISDKENDDPNNNENKNKSPLINQQAQQNIKKSPPYHNIYKGTQDRIFNPYEWSIQDFEIGRPLGSGKFGHVYLARERKTKFIVAIKVLSKKQLIDNNAEIQFRREIEIQSHLKHENILQMYGFFWDDKKIYLILEYASGGELYKELKSQPLRRFDEVTAAKYIKQVASALKYLHSKHVIHRDIKPENLLNCDGTIKISDFGWSAHAPSNKRNTLCGTLDYLPPEMVEHQSHGSHADLWCLGILTYEFCVGSPPFEDRQNKKTYEKIKQVDIKYPDYLSSDVVDFISRLLTKQPSKRMNLEQALNHKWVKMYNEN*