TTHERM_00688480

Length: 280 bp

protein Sequence

MEMLLDSLYNKFGQNAQFLENCWGSLEYFAELPTTNIEDSKKRIDLSQYESKVLSIKILDTQCAYIFKKWTLEYALLIFETIIVFNFNQQNNQYAFFYIQQKKDAIFLNRNDPLILFMHLIQNSEDQEILQNTCLALEQIKIFMEKSSKYCKIPEVKRIDVEIEVRKDVKEFLDQKKYTRNSSKKQTGMPLVLLEKSGVNKFLNQDSDDEAGDGKLQRSSSISDLVSQFPRQLEYWLYEGNSDKLMIQKNDFIMESLRIAKTIPSFKKMGQKYCQSALSY*