TTHERM_00689850

Length: 170 bp

protein Sequence

MNQRKNQTQQKKFNPADYVRPGVTEDEVIEIKEAFDLFDMDLGGTIDPSELQAAMRSLGFEAKNQTIYKMIADLDTDQSGQINFAEFLNLMTARISDKDSREDIRKVFMLFNDENNVGISIKQLRRIAQELGEQMDDSELQEMIERADSNGDGLVTEDDFYNIMTKKNFV*