TTHERM_00695770

Length: 101 bp

protein Sequence

MSSSKEFCDKCDSIKETDPQYETAKKLMMQQGCFQENKNLTDCLNLFHKDWRSCKVKAQLNYLILNINQAIYLFSTQMSFTLIKQNETDLLTKCIQNSKKQ*