TTHERM_00711780

Length: 339 bp

protein Sequence

MSSTTSNQAAVQNHVAITEALQQKNNIQKDGIKIDYKHSAFVEFCKYMTGPAVVQAVNKTIFAPLERMKIIHQAQNALYINEKAKFKNFFQFLQRIPTEQGIKAYWRGNFANIMYIIPRTIAQFAFFENINHFFFPAGEKNITELEYALRKFSAALTAGFCTLSLAYPFDLAKTRLSLEFAKNKYDKQFTGVLSALGETRRRGGFTGLYKGFWLANFTNIPYYLTLFTNLQIFKSMNQSEVSNSELFQYLAPASIAGLVSTLVVYPLDTVKRRLQINGYNGNFMYKGTWDCFKKIWDKEGALSLYRGITITSVKFLGSAALQTILVAYYSQLKKQYSLF*