TTHERM_00717520

Length: 180 bp

protein Sequence

MNQIKALVYIYSQSFFNSLQFNYSTNKQISKYIITFLTKKSLQIIINSQQTNITNEYFLHLIYSNKQQKILQFKNRSINIYKCYEQQLDSKHQLNIINKIQLVNILFFFKIIHTQQILASFQFQEISYLFEKGKMRKLNSRKTPTRKNKQTNTLIHDYQFAKIGLINNSKRMNQSIRINS*