TTHERM_00725960

Length: 245 bp

protein Sequence

MFRNLLVSALNQKRQSLFQTVRRNFLTKKVDNSQELTQFLTETKVVDSKVFETFKAMTANQDKIFIFKIHGLSHFFFTYCRFSVFALALATMAHLGYYYDKKMEKYKENNYENRQKRSKINFATGALVLFTIGGNVISFIMGKRYLKSINYLPKTNQFEFNFYGLICQDKPYKVELNEVFRVQRKLLDQTVQFQIQNKNCPHTYFSSKGTGWWSNKKLFEYIVDQNKLSEMPKQQKIKKLDKQEK*