TTHERM_00728900

Length: 386 bp

protein Sequence

MENEIYCSIHKNKLIDAVCLEKECSENSLICYNCRDTHQDHIQSCIHLQDLIENIESRFNLSVKFRNFGMNKQKENIFILEQAKNQFKISKKNEKNNSQMLNSLDRRQNSLEIVHQDLINKEFQQSQQYYQQIADDVIQYMNNFETLWRNQTKNSAFIQEISSPLTNSRTQINNTCLQKIHQDIENGILKKENPYQQFLQSSSKQNQQNIHNQIYDDEKRQIDQTFKNNYINRDYEQKFENNDQVVQINATRCEQSPKILKEVQAPLFGNFQQSIIFNQNQINDDLQQIGSQRLYNDKQNCFQNSSLMNTKPQQNYGLENSQAIKQYTFSDEQKFNRASSENLAGKKSINSQSTNTHKSSNRYQSKEQKSQDQQQQSQLDSKQAQV*