TTHERM_00729160

Length: 481 bp

protein Sequence

MDTLLDKKDINANDKDLLKKKKKNTFSQKEVFSDGYDTDGYKDEEDRKKLNQMNEVDRVNELNRRLEERNNKKFDDKIAEKAEKVKTTAGAAVASNIFVDPTNGLDQSKKSQVEKDKMQLKKELETKREKLKDSNSHSNNNNDYNFSQYDDFKSQTHGLAQHQRERNTQSEEFQKLVKQLTLSKDYLNKLLLRSYFHELVKGVYVKVRIGTKYEIYKIEGAHSEGNNTVFTLNNGLKTRKIDLQYISNQNPDQVELCTYYEQNKHEKLQSLVDKKKQFDDLINKKQEKSEKQKYQEIDQQISQKIEQGYYEKQNNLNANEIQTNIGFYKDRILDIDYIEQNQIQVGKSELEKLQKDKVRFQKNVEYLQKQIKLVKHQIVPIFTKNVLEMGSKISEQALNKKNAKIKDKAMIRRQKIQKLQQPYFAFEEQFKQLSQYSTSILLKEIIKNNHSSLHLSSQIQKDLSLIDCSDQTMQSLISNKK*