TTHERM_00732520

Length: 359 bp

protein Sequence

MEETQDQPVDVRALAKKKYELYLQQKKAHEELERLGLTNEQIEARINSSSQQQTQSKKQEGEFQKFQQQQSLASNKQSNDYDRQQQRNQILTELTMKITEKFQKELAQDSKNKSKQKEGMQLEQKISKEIENCTCPICYELMVPPNNSPILIFPCGHTFCKTCIIPKDKTKLNKCPFCRKPLQSYAVNIHLQNIICAYTDNKHLLEKYKDEIEDINNSCLDNSQQKKGKQMAANMDNINVEGQTFEQNYKLFSLRCSILEQEKDEILEQINKQQSTIQTHSAVIESLQKQKSTVQQKLQKLQQELLLVENFIDQNSKALDEAEQNLSKETEKLELLNQTLIPLQSERQKYMILSQNQKK*