TTHERM_00746920

Length: 304 bp

protein Sequence

MMNQINKERTIKIFIIKNITIQNKQTVFTKVLQLKILGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDILKLHQSVVFMKSKMIKLENIFISIHKHLDQFNKIKNPDLVDDSVKIQNCIDISDILIEYKVNLSSNSQEKLSFKNMIKFPFRNLNKFASNYKREEDLSYFIKETTNESSKQIQATSSQQGSKQSRKQQAKLQEQKQRKQKGNVKQSQVIELESQENNQETNNNDSKSEKSGQQVTGLRQKSTRNKTKLIDSDYVYFTPPKISQLTHFAKPEPKLDAPSSPIQLPLFKY*