TTHERM_00752220

Length: 220 bp

protein Sequence

MKSSNQTQIYKSDFQILKEHHKFLRDDEKDSQIQYSNPTQEQYGEILAKKYYEKLYKEYAIIDLSRYETGQIGMRWQTKDEVIIGKGIVICSNKKCTNTQNLDSYEVNFAYVEDNEKKNALVKVRVCQECVLKLNYKKQHQKVEDKNFEHSSLTNQQQQPNQNNEQSGNLKQLNEVQQNNQHDKKQKKTENDHLDVQRKIKKDKKKKKKHKHSKNDDEDE*