TTHERM_00753580

Length: 128 bp

protein Sequence

MKQFALLFLAFVAITTVNAYISKDQIYQFNNCTEKIQLPCDRSNTDCLKQKAKVEDCLDYCFDGNWNTLSMGDVNNCYQDQCIPYAKNSTQSTVRTYASQLGYCLSSGIISFAFILLAVIVSVLFVQH*