TTHERM_00770690

Length: 101 bp

protein Sequence

MTSVFKRLVPTFNRILVKKFEAETKTRTGIILQDPADKTAYGEIVSAGPGNFDNNGKVIPLGVKVGDIVVLPDYGGSKINLKDGEFFVYRDTDILGVLHKN*