TTHERM_00770740

Length: 205 bp

protein Sequence

MKTPQKKTFSYLHISRKILEKDEQKLKKANEAVENKNNANNNQNNNSSNANNQEESDEYLIKELEDKKKQRCKYYPNCKNEKTCPYIHPTEPCTFFPTCKYGSQCINKHPDCKYGKSCQRPDCFYEHPFPSKNKYNFEEIQLTIFYQTEKQAINPFLQMLMMPMMNASKRKITNKPNGKRPFPGNTPGQLQGGEDQKSEDKQQQP*