TTHERM_00773500

Length: 192 bp

protein Sequence

MDAAKKVNKFIMKNPENADFNQYWYSPKTIEILVNQVLKHGKNCAFLSTPSIFYSINDAQFLKQCYVFEFDKKFEKNNPNFVFFDFHKPEDIPAQFHNFFDFIVIDPPFITRDVWEKYANAAKIIGKKDENNKFVANVLASSIDENDKMLDELLGLKKRVARPLIPNLVYQYSLYSTYEDESLNQVNEEIGF*