TTHERM_00777060

Length: 783 bp

protein Sequence

MSYQQENFHLVRGKLLAVMTVQFAESQSEDIEIYQNDDPRKLAEEFIQKNQFDESILEIIVENININKNLAMEEYNKNPDNFKVQKDSDFNNCDQGEEHQAQQKPNEKQNDAIKNIQNDSFIQQKLINQQNNYNIQNKENSDDSHNHFIESFQNQEDFKGVNNLQQKEDDDYQAYQYNLMMTQKAEQFLQQKNSFQWQQNDFKKQKSDFQSQKNQDFQQNNQVRVIDNNDFSSSPANKLQLIRNQFKKNKVSDKNQSTSQSPNTSFQKQKMQSDRALFEQSQKENTAKTCFSQKDDIYNSPQIIDANLTSKKKLMTQSSRSKSPNYLASSLSTSASIKNKDVGYIEKIIQKNYQNQFQNIFEQSNNYNTKSTSTYRILHNTENDPKPFQPQISKRSQQIAMEKNKDTSPAFIRLHNQKIKTFIIQAEPPQNENFEQTKQNLNKEKASDKSNTTSKKLSQLEIMEMSERMHLQAKRHEDKLKQLKLFYEKMEKEQLQQDFGKLYIAKKSKSPQKKSHGIIQKEKQSQKEDKRTADWNQMKQNENNIQQFYYKSRTPERLKIQQNLNVRKSSQSPIPSNKSKTQILTPKQQNKICYSPNKTKQNNTYQPQQMQMLLSSDNFYNSRSPNKNQGKGHEHLAYRSDDQVKMSHMTIHTLKIDSLRKQKRINDIFTVLDSDADGFISSNKINVTALPPPLLKIISPILYEMEEYNFNLSYEDFIGSIQLLEKTLSDKQLEILYYQTDDSTKYKFYKQKQLTNISNLSYEQLQKIGRQIESCKGNIHFKN*