TTHERM_00780600

Length: 550 bp

protein Sequence

MSKKQQADILQPKKVTNLKDLMNVGYFEYAQKGDSIYTLVPYVTNKQLHNYTKILEKNKDPQNVSEQKQKIKNDIKREIENLRKEIGGCYDVLKNLGSFQVVKTERFDLPDNIKAKDVITSMLIRKQEISVTRKMFQDGLQSIRECLEQQENTIKQQQKYKQSFYISQSSQVSSYKPFPYKKIDNQIYINFYNIPIFNDNQIAPLNISPYLLFIPLQYKNDQITAKLADVYRTTPDIFEKQLIIKVVKNNTLGQDPEKLGPTIQQISFLFKPQLSEEDGDEDDESQIQKIYQLRYRVYERVIFNKLINICNKFVPKQLYIYDTSVYPNLSVQLITSKFFSYQQTIKILQIFIDDSYTLKFELKKLSQEEKRFYDKKNSYMSRKQQEENIANQISYSTTRSPYTLNLYSNLFNYMTKMPSHRSLIKYIIEIKITIAQKLFLYQPRFQINVIRNQNEEVVYIGAHINRTSSKSNQEQQYDTQLKITPFTTEFQQLNKLSYTFSNSLSEIPRFCKEMLFVSDTGIISQRNQLRNWELAQMNLQQQMMPAQTPQ*