TTHERM_00784490

Length: 82 bp

protein Sequence

MAQNTNFKTECASLNVQNTQVLFVFFLLISPLCRTYKLTNNQNLFESEQRFPNKKNDLECFEFSNLLCQAKMSIISSAALDE*