TTHERM_00794670

Length: 79 bp

protein Sequence

MPKFPKEIEYSDTYNDDAYFYRNVRLPQDLYKKIPKGKIMTEDVWRSLGIKSSKGWQHFYVYKPEPFIIMLRKPVNFQN*