TTHERM_00797910

Length: 131 bp

protein Sequence

MSTQDNKQQIEKQVDKFTNALVPVAKEFTAGSVFGFCAGYFSRNAVKYAAFVTGGAFIFLQILSHKGYITMNMDKIEEDLKNAADLDGDGKLTTNDAKVGLKKLLSIIGDKVPNAAGFVAAYFLGLSGKLL*