TTHERM_00803600

Length: 274 bp

protein Sequence

MIAKALQKVLGNSSMKLIHSRNIVLKQRCFHSSVDSSEMNHFSQIKDWWKSGSEMAPLYSYNFARVNFIKEFMKDFNNQNYHLKLPLKNLQILDVGCGGGLLSESLCRLGANVTGLDANENSISIANNHKKLDQFLEQKLNYKLGTAEELSSQNIQYDLVTCMEVIEHIQDKEQFIATLSQLVRPGGMIFLSTMEKTRESYLKLILGAEYIAKLVPKGTHDWNKFINSEDLSALLEDNGFKILKIQGFSYDIINNQMEKSNNKMNYLISAIKLR*