TTHERM_00805850

Length: 117 bp

protein Sequence

MFINIIYSINGHYKCEEQKVNYHNRRKKKRKEQEQKSKSKRYQLAMDPVLGDVIATRIYKACFKHVYGKNMKAYSEKDEAKFDQCLTSYVESYKSVTNHFITYLGQLPKKGLSLDGS*