TTHERM_00846910

Length: 298 bp

protein Sequence

MYSKSVVQTAQKKSIIDIFKSEDKDLSKKKQLEQVVQGEIWVVKKFLSTKQCQEVIKFSESQGFQDALVNVGYGLGVLDKDFRDCNRVMIDDVETAQYLAEKLRPYVPLCQEGALYHGMNERFRILKYSKDQKFAMHQDGCWSPSKSIFSILTIQFYLNTVDNGGFTRFEWEGWESNEYKCKSEEGKIVIFRQQGWWHEGSHVLKGLKYTVRNDLMFKLYTQKEWEQQKQLHDLTCGVCSKKVKAEVLQCGHLFLFCGCHAFYNGDIHTNPEEKKRLRSCCQCVKKIQSPSKELYEIL*