TTHERM_00848090

Length: 320 bp

protein Sequence

MAEDRKKIQTHRFYEQKYPKENDLVVVEVVKVEENCCYVQLLEYNRIEGMITPNEMTKQMQQSIQKVLKIGKQEVVQVLRVDEEKGYIDLSKKKVRNNQDNACLDRFSKAKDIHSILITVCESLPQDCSVKIDDLYTKIVWPLYKLFNHAYDAFRFALNDETIITKIDIAAEVKEKLLQVIRRRLNTQPMRIKADFELRCHEYEGIDAIKAALLAGEAKSRNKCDVKFEIIGSPVYAGCIVTQDKNLGIEVLNEALKAVEEVIISKKGSYKLRTEPKIYGDKAQDNLEMLEKAEEEDEDDEDSEVEGMGDDDEEDEENDN*