TTHERM_00865250

Length: 118 bp

protein Sequence

MNSQTIRAAHILQKHRGSRNPLDRVRNVQVTRTLDEAKKNVAAFREQIMKSADPQKTFMEIAQKYSECTSARNGGDLGEFGPGQMQESFEQAAYALKVGEISNLVESDSGVHIILRLD*