TTHERM_00881320

Length: 349 bp

protein Sequence

MNRFILLSIIMLMPLCLAQNVSVEKLLAYNKWSSEHQRVYLNEHEKLFRQMVFFENLQKIQDHNSNPNNTYSIHLNQFSDMTKQEFAEKILMKQSFVENFMKGASQQDNNTNANHNEANHNDANHNDANHEMQLNSKNFTIATSIDWRSRGAVTQVKWQGNCGACWAFSATGVMESFNFIQNKALVEFSEQQLLDCVIPANGYPSSGCHGGWPVQCIDYASKVGILNQDRYYYFGVQMQCRVTGTNNGFKPKSWVQIPNNSDALKTALNFSPVSVAVDGTNWTDYKSGVFNGCDSHVSLNHAVLVVGYDEQGNWIIKNSWSTLWGEGGYMRLAPNNSYGILNLGYQITS*