TTHERM_00900600

Length: 495 bp

protein Sequence

MNTIS*NLVGYEEAKYKLA*HLQNRKKIKEMYKMKGLEMLDKPELVFSDI*EPKLKPY*ASIY*IMKSELTKKGYSDFRYLGQGSSGLVLLAKDSKTNMRYAIKGV*VRDPHGNFD*DIYIQVKREIEILKTCRDSPYVISLLD*FEG*QFSYLVLTEC*GTLT*IIERNKNKRLNEISAIKYASDIAQGLYYIHSKSCLLNDLKADNILIDYHGNAVLCDFGTADNQINISGYSINQYMGNILYQAPESLDPAEPFIGKVYHDEYLKLGVSVRQEPS*RGIDFNLISNKHKPLNYDAEFKNFVYHK*LKYIIDGLTNFVPKNRMTIKEALIILKGIISIEF*LDDMLIETIDGNTQQFASSLKNEIEFVKDLSNKFYPIIKN*QTL**ELKEDHQKR*YEAKI*EFLKINL*L**RINE*EKTIKDLLSQLN*F*N*FMNEN*IMMMPTMKTNNK*HFYF*EIKK*EKKDELLKEKN*F*IQKISF**KPIKLL*