TTHERM_00926990

Length: 152 bp

protein Sequence

MADQKHDQVVDQVHKKLKPNELITTVNTDKAPKAVGPYTQGKIVAAGARLFYASGQIAINPETNTFDETSCVVSQTEQVLKNLTAVLHEAGTDLEYVVKVNIFLDDMDNFAKVNEVYGKYFTGDNKPARACVAVKTLPKNAKVEIECVAVVP*