TTHERM_00942660

Length: 314 bp

protein Sequence

MDNIPLIPNNQITLQVTIKNLLLICVAVVVIYSSNQLINIGYLPFLQAVIIALLSCTLVFSISSLFFLHNYKKYPNYFNTSNILTITSLSGAFILTVSSLVTSISYTCGRELSGKDIVDNISNWQCGSSGDCDIGEAYYYAAKYVYGLCYQRLSCYTDSLAVYKRGYALAPQLVGCIGAGLLLLMYLFTFIQNRRKLNELQMMPLNSNQDDLNQQFRNNPLPYQVQDRSNTNANPQYHQNYQQNPNDQQQQIKKQQYQQQQQQQVLWQPNTQQSAPQANYQGNSYNNNQNVPQVNYQEQNKQAVSQQQQQPQNI*