TTHERM_00942680

Length: 45 bp

protein Sequence

MLNTNVQDENVMIATWRQGKQPIFINQSEEQKVVATMKSNSKLQK*