TTHERM_00947500

Length: 314 bp

protein Sequence

MDYKNKSYFQVPGEADRKNAIGSLAGVPIKIKKAIQAIQNEFQKIDAPQQGDWLWDHEELGQPYEQYVSTFEKRIFNKENSNTIYIQPLEQNMGFNKDLKKFCKAFFKDCRVKVRQPIIIQDIPAVQRRINEYTQKLQLNTKDILNYLKTRLPKDAVCMIGITNTDLYPKDEWNFVFGQASLIHGVGVFSFARYLYKSNDILSNTLEDQDTIIYRACKIMVHEISHMFGLRHCIYFKCVMNGCNHQEESYKSPLELCVICLRKLQNNIGFSIIERYEDLIEFSQDRPYFSEIDVPIYEKLKNLIKTAYGPHYQK*