TTHERM_00957580

Length: 198 bp

protein Sequence

MCFGSSSKKQQSKPKLLKPKQSQYKTKLILLGDMNVGKTSICEYYKKNVPAKNLPNTIGVTYFEFDIKLENGINVHLDIWDTAGQEIYQSLLKIYYQDANIVFLVFDVSARQTLERVEYWISELKEQVDDKNLKLVLIGNKCDIDADKRQISLEQGQDFARNKNIPYFETSAITGEGIVEVFRQTVKDYVQYKTNGGK*