TTHERM_00962060

Length: 362 bp

protein Sequence

MEYRFLGNTGLKVSAIGFGNWLNSDTSDRQQKMIELVKRAYSLGINFFDTAEVYGFGEGEIQFGEAFKALGAPRQELVISSKIFWAVPPTSSDLKKVNQIGLSRKHIFEGVKASLKRLQLDYLDVVFCHRFDEDTPLEETAKAFNDLIEQGLIHYWGTSEWSASEIFEVREVCARLNLTPPVSEQPQYSMMVRDKFEVEYGRLFDKYRLGTTVWSPLCSGILTGKYNDGTLPAGSRLQEFKDNIFLKRIYDQYFAEDKKEKLLKLLNGLASVAKKLGCTQSQLAMAWVLANHDVSTAITSATRPEQIDDIVKSVEVIKKITPEVNKEIDEILGNKPMPGMDVKSFGLKKHTRRELMIIKNQY*