TTHERM_00966510

Length: 578 bp

protein Sequence

MDKITIQSLKCNKHPNKNLQFIQVNDVLTQPVSNKPLFYCSSCFNHDLHFKSINYLMIDQIFQEAETNIIPKWPPVNNYQIISDLIDLNSNQSSLDYVKQITDFFNQFKEEFLNKIDIIQKQTINEALKYPIDTQQIIKRYQEISNILQFKQILNNEQSNNLQDHSTLCKEFISQMESQKDKNTELLQSLLTQANQLKTNFNMEYPQIIKQQLFTFIDNISFFNLGIPEVSSTNHNNTGNHQETNIINQSNFGDLKLTSDLIMKLVSNKSNFCSDQFLNKLSEILQRINPLLKQFTFNTAVFKENKEQIDFSKISEEKINLIEEYVKHSIALSRGEQQYEQEVKDSLEIKQMTQIVDSKMSFLKQEFIQQFEKFLVDVKPFLKQINFTNTFTDKNKFDQFRKKYLKDKQLCVLFDEIQFISDLKLFATQFKNGQRDSVVNKRENGYYEIEKLNNNDWVNCLMRNLNADLKVGYNDYLSCYLKKNNQSVIKHGGLGIDKQLKGAGFKTSGENMIELRLCLKEQILEVLDYPNYEYKLGLQDQYKEKLTQFDDLRFYLGIYDQGSKLILMDVKIVNEFII*