TTHERM_00997610

Length: 288 bp

protein Sequence

MAAALLASGIDPKKSNIFVQSAVPYHAELQWMLGCIAPQNWLNTMTQYKDKKSKNSSLGLYSYPVLMAADILLYNATHVPVGSDQKQHLELTRDYATRFNTLFKNDKTQGISMPQYIECNSIKFHEIVNLIQIFQIIQAEFPRVMSLKDGTKKMSKSDPSDFSRINLTDTPEVVYDKIKKAKTDSIPIVKLDPNRPEVTNLIRIYSSLSGQSIKEIEATFSSSSMKDFKDKLSELIITKVCPIGLRIEDLLSNQDYVYESLKQGNERAYDRAKENIQRIKKEMGMYVM*