TTHERM_01005160

Length: 430 bp

protein Sequence

MSKLLALALILSLLGTALALYDNNSKVIKLNKSRFQNEVINSKELWLVEFFAPWCGHCKSLAPEWEKAAKALEGIVKVGAVDMTTDQEVGSPYNIQGFPTIKFFGDNKSKPQDYNSGRTANDLINYALNEAKSIAQRRLSGGSSSSGNRQSGGSKGNANADNDGDVVVLTDDNFDANVVGSKEPWFIEFYAPWCGHCKNLQPEWNKLATEMKTEGVKVAKVDATVHPKVAQRFGVNGYPTIKFFPAGFSSDSEAVDYNGGRDASSLGSWAKEQRDAKKPIMFTQLLNQSIYDEYCTNNSGVCIIFLLPHIYDSSAAQRNGYINLITEIAQANKGRPITYLWSQGGDQYDFEEKLNAGGSGYPSAMAISHKKNLYQIFKGSFKKKDLDSFISGLLTGRGSFSTLPTLPKIKKVKEWDGQDAEQQQTDNSDL*