TTHERM_01014790

Length: 548 bp

protein Sequence

MKKYERKQRKVLIIIDNNKQEKRTNESNQFDKKKNFQIAADDVALGLIKLIHSKKESINMDFQKLREILPKDPLIWSQEDVLEWLKFIGLDKYAPQFKENTIDGSCLNTLTSDDLQNHLKIDNAIQRKKILNWISVGIQTYSQYLKTFQEESKPNQIVLSELNQNSQQIMMIDKIKANNYKKMQSFEETNVSNRQSIQNFANEDKYLFEMNTNNVKQSFNDKFQGNAYKQDNQRLRLPVCNSKLDSSSEEDKENIDEYTQAVDQQNLEVNNNTSEDQTALKNVLIIEPVEGIQTNFFCVKEDGGKIGRHSSNQILILEESISRYHAEIVYQDKKFFIKDIGSSTGTFIKVKDRVPITLGMLFEMGSFQFEVSDLDFENQIIDLDILEDSKPTNPKHYKLEIKNSGDQPGFVSIGRKPSNKIKLPDDQHLSNVHAKIYFMNNQFFLEDNASTNGTWIRLSKEGYTSETWEIQNNTIIKIGSTSSYNCRFDHEVQKEALNDACFICFSQDKDAVFLPCRHNSSCIKCSKTLQVCPICRTKIEDVVKIFKA*