TTHERM_01027480

Length: 417 bp

protein Sequence

MNLSVSRDIFDHIKQRMGQQIEIRFIAACRIWFFSNNRWSFSNLQGGLALGLDKSISDELKEGRDVFYMFDLNTFDVTFRLYLYKFFHEFYFKLNDFFYYFRLSNTQTLIGFSFSNKQEADLLYQEIQFITDQEKELKEIEEMNYPELAQDSKLRENFENDKPLQDINIEKEETRLLNGKLKKAEKDILRKAGVSKKDYENNVGGIKNNVINEFLSKYKRKKEIHENMIQQKQQFQPISNPEANFEMLRKNSVINTQNAALIHVSQTNANTFQSTSRLRQSSTTKTSMIKQRNSTILGAAPIIPQAPPLVKLLENDSGNQQTLNAYQSQGNSSLIAAKPKIIAQEVKQSLMEEIKGMKYKLKPVTKVNPLVLTKEESISLTYKINAQIRERRKELKKNFLDEDQENSPWDSLDEEND*