TTHERM_01027710

Length: 481 bp

protein Sequence

MNYEDLEKNVKIFESEMIRKNMKAFTKIDEVEVNYLNDKRVSPKMIDEITLDLVKQSPTMLHLFQNIINSLKRFEQSGMYKQVEVELLPGSKKDSVLVQYRFMPSSFYFANISHQFDRFGQASMTTKLGFRNVLGLFDKLTFEYNKALNKSKRSYYNIQWNVPYNFLKSKAEDNFLAQISHSSTLLDQSCSETKDSCQIIYTNIDNKNEQEKYSLSFESAYRRNYVTLPLYRNLEDFLPTTKHSIRYATTAFSTIKMGSNVHKGSSLNYSLEFGLPLLSDVVFLKTEANYKAYWKLKTLKKVSDMFKHVNIEYSGNLGLVKTLNNDKLHLNECFQLSTIRGVNDINVDYIPQGDQQINQQQPPHNISNFLKDNLNLQLKSSIKLNLYNFPGTSKSGVIPFYHASAGYFYRVRNGYGGYPLKSFTKNDIAEHLKHHFRASAGIGVGLSMGPSTKVELLYNYFQFSRLSDNRANIELRISVDD*