TTHERM_01035700

Length: 46 bp

protein Sequence

MGLPIRNIQFARYHYLAAVTVFTYFATRCCLLDYKKYYPLASVKKI*