TTHERM_01062900

Length: 168 bp

protein Sequence

MKALFALAVLLVTASCQVYPMNVGNECSTATCSISYWQYNNTNFNYTCPEAGKSMARFRIAQGNYFLDFVAYNPLTSDSPVTIPLFYNPNPNQSGLQYYYSLQQGHNFVILNCTLTAAKQLTSLCSKHALVGGKIYKDVFQNACAFGLDAPRYAFLQQEIPLEFESSI*