TTHERM_01074550

Length: 367 bp

protein Sequence

MKLAQLILFSLLSLTCFCQLTSLKSENKLENIKVDDLILFNKWKFENKKSYFNHEEASFRQILFLKNLKNINFHNANKTHTYKVAVNQFTDLTQEEFEASYLNPILTQAEKLRFLQRDGGQNGGKDGGSNQTQNCTDVKNCQNPPPPVIQPLYNVSQSIDWRQSGAVSPVKNQGSCGSCWAFSAVALAESVNLLRNNSLALYSEQELVDCTYKNPQYYNYGCQGGWPSVAYRYIKDQGISSQQNYPYIGQNRNCSINSASPPKAFYAKDPIYYYTNNGNQTNLVQYAVNQAPISVLVDATNWSSYSQGVFNNCGNVTINHAVLLVGYDTSGNWLVKNSWGTNWGQKGYITLAPGNTCNVQSSPLGGL*